Saccharomyces cerevisiae (strain FostersO) (Bakers yeast)
Taxonomy: cellular organisms; Eukaryota; Opisthokonta; Fungi; Dikarya; Ascomycota; saccharomyceta; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces; Saccharomyces cerevisiae
Average proteome isoelectric point is 6.69
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 3,560 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|E7NFN3|E7NFN3_YEASO Sed1p
MKLSTVLLSAGLASTTLAQFSNSTSASSTDVTSSSSISTSSGSVTITSSEAPESDNGTSTAAPTETSTEAPTTAIPTNGTSTEAPTDTTTEAPTTALPTNGTSTEAPTDTTTEAPTTGLPTNGTTSAFPPTTSLPPSNTTTTPPYNPSTDYTTDYTVVTEYTTYCPEPTTFTTNGKTYTVTEPTTIDYH
MKLSTVLLSAGLASTTLAQFSNSTSASSTDVTSSSSISTSSGSVTITSSEAPESDNGTSTAAPTETSTEAPTTAIPTNGTSTEAPTDTTTEAPTTALPTNGTSTEAPTDTTTEAPTTGLPTNGTTSAFPPTTSLPPSNTTTTPPYNPSTDYTTDYTVVTEYTTYCPEPTTFTTNGKTYTVTEPTTIDYH
Molecular weight: 19.23 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|E7NKA0|E7NKA0_YEASO Srp40p
MLRRLKRLKLNQKALPHRSQALAGHRHLRNLNQVRNLILTQVLAQAVLLIPNQILNQILNQVLAPALATLRLTPTPAPATLHLTSTLSPALAPALAALPRIQIRIQIRIPTQARLIQVPTNLHLLLIPPIRIPTQTLVLALNWKQKKQLQTNPRPKKRLPHLTNQLHLLPVHQAPIN
MLRRLKRLKLNQKALPHRSQALAGHRHLRNLNQVRNLILTQVLAQAVLLIPNQILNQILNQVLAPALATLRLTPTPAPATLHLTSTLSPALAPALAALPRIQIRIQIRIPTQARLIQVPTNLHLLLIPPIRIPTQTLVLALNWKQKKQLQTNPRPKKRLPHLTNQLHLLPVHQAPIN
Molecular weight: 19.93 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
1,210,990 |
100 |
2,053 |
340.3 |
38.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
5.76 |
1.34 |
5.81 |
6.39 |
4.44 |
5.42 |
2.19 |
6.42 |
7.16 |
9.36 |
2.11 |
5.8 |
3.93 |
4.36 |
4.5 |
8.61 |
5.87 |
5.79 |
1.1 |
3.41 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |