Bradyrhizobium sp. Leaf396
Average proteome isoelectric point is 7.15
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 6,972 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0Q5ZRG8|A0A0Q5ZRG8_9BRAD Uncharacterized protein
MLQSLAQGQSITQVYTVTFTDDHGAQVSQDVTVTINGANDAPTIISSAADAAGAVTEDSATLSIGGTLEIQDLDLIDTHTAEAIFKSATSNAQLPGFDGSTPLGTFTIDGDVAEFNXSNAQLPGFDGSTPLGTFTIDGDVAEFNTDTDNGASLGWHFSLDNSNAVLQSLAQGQTITQVYTVTFTDNHGAQ
VSQDVTVTITGTNDAPTLADLHIGSLADTAAADTFSDLTGTLVGNDVDTGETATLSYAVLNADHHAVTTVAGLYGSLTVNPDGSYSYVPNATAINALSDGAYTDTFTVQTKDTHGATGTATLTVDVTGTNDENDAPVIDVNQISVSQEGDQVFVHGITVTDADAVDGETFTLSAIADSGTYVDPASASDT
FGGIASALQGLTYTDPGQNAPATTDTVTVTVTDGHGASDTVNLIFNLSEQGPVDLASTTGKDVLFGSGYQDQFVFEANSNHDTILDFAHGQDHIDLTAVVATDIDAAWIAQHVAPSGTDTLITLSATDTILLKGVANVQPSDFIVHA
Molecular weight: 53.98 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0Q5ZFY1|A0A0Q5ZFY1_9BRAD 50S ribosomal protein L34
MKRTYQPSKLVRKRRHGFRARLATAGGRKVLAARRARGRKRLSA
Molecular weight: 5.09 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
6,905 |
67 |
6,972 |
2,117,668 |
26 |
4,378 |
306.7 |
33.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.49 |
0.86 |
5.5 |
5.44 |
3.73 |
8.3 |
2.03 |
5.32 |
3.65 |
9.95 |
2.48 |
2.7 |
3.18 |
5.23 |
7.17 |
5.65 |
5.3 |
7.45 |
1.33 |
2.23 |
Note: For statistics only major isoforms were used (in this case 6,905 proteins)
For dipeptide frequency statistics click
here