Virtual 2D-PAGE plot for 3,126 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A058ZHQ3|A0A058ZHQ3_9RHOB Hemolysin-type calcium-binding repeat family protein
MLTLLMLGGLLSSVLIYEAVVDDDDDDVANDMPIEPGDDTGDDTGDDTGDDSGDDTGDDTGDDTGGDTGDDSGDDPVSSTPTEGDDEIFGTPEEDDISSLGGNDIVYGLASDDDLFLGDGNDIGYGGPGNDTINGEAGNDVVAGDLGDDTLNLGDGDDTNAGPDIVEMFSDDTDYNVLLNLDGDALAESS VAGDDAILGGNGNDELVDLHGSNQLDGGEGDDFIMSVDAQGTDDSIDTLVGGAGIDVLVADDGDLISGGADVDEFIVWFDEENDLAVQIVDYEPGEEVYIIIDSSLLGEGDSAEPVLTPVDGPVDALSIEVAGHQVAFVLGTADPDELDPYLFVEVLV
Molecular weight: 35.61 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A058ZMF3|A0A058ZMF3_9RHOB 50S ribosomal protein L34
MKRTYQPSNLVRKRRHGFRARMATKAGRKILNARRAKGRKSLSA
Molecular weight: 5.13 kDa Isoelectric point according different methods: