Isoptericola variabilis (strain 225)
Average proteome isoelectric point is 6.18
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,879 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F6FS94|F6FS94_ISOV2 Putative uncharacterized protein
MRTCVRRALRTALVTGGLVVAGATMAHAADGDVVDISIGQDTSVDLNLSQVSEETNDAQLETPLDLPEVDTQAVETLVTDVAGDGGVVDDVLGADEPEETTTDDLYDAVAEDVRQTVEDVTAGDVPAVVDDVVAEEGVVDDVLEDGGVDTVVADVVEETGAVDDALGTGSTVQDTVDSVLGDGGVVDDVV
GPDEPEEGTTDGLVEAVVEDVDVTLDDTLAGDVPAVVDDVLAEDGVVDDVLEDGGLDTVVSDVVDGTGTVDDLLGTDGLVEGTVGGVIGEDGLVDDVVGADEPEEGTFDEVVEHVVEDVRQIVQDVLEGDLPGVVDGVLAEDGLVDDLLEDGRRGDGPGDGDGPGDGDGPGDGDGPGDGDGPGDGDGPGD
GNDGTDGNDGNDGNDGTDGTDGTDGTDGRDGTGTGSGRDGGLTGGVTGGLQGGVAVAAGGQGTLASTGADAGLAGLAALLAGLGLTLLALRRRWERAAVATPTAG
Molecular weight: 47.7 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F6FUT3|F6FUT3_ISOV2 Putative uncharacterized protein
MGSVIKKRRKRMAKKKHRKLLRKTRHQRRNKK
Molecular weight: 4.08 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,859 |
20 |
2,879 |
982,165 |
30 |
3,247 |
343.5 |
36.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
14.28 |
0.54 |
6.51 |
5.98 |
2.59 |
9.36 |
2.15 |
2.8 |
1.51 |
10.06 |
1.59 |
1.52 |
2.5 |
6.06 |
7.98 |
4.7 |
6.19 |
10.25 |
1.55 |
1.87 |
Note: For statistics only major isoforms were used (in this case 2,859 proteins)
For dipeptide frequency statistics click
here