Bos taurus (Bovine)
Average proteome isoelectric point is 6.8
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 24,480 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F1N2I7|F1N2I7_BOVIN Uncharacterized protein (Fragment)
DLLGEDSLAALSSVPSEAQISDPFAPEPTPPATSAETSAAAASASTTTTVTAVTADVDLFGDAFAASPGEAPTASEGATAPAPPTPVAAALDACSGNDPFAPSEGSAEAAPELDLFAMKPPETSVPVVTPTASTAPPVPATAPSPAPAVAAATAATTAATTAAAATATTSATTTSAPPALDIFGDLFESA
PEVAPAPKPEAAPSIDLFGTDAFSSPPQGASPVPESSLTADLLSVDTFVAPSPATTASPAKVDSSGVIDLFGDAFGSSASEPQPAPQAASSSSASADLLAG
Molecular weight: 27.72 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|G3MYZ9|G3MYZ9_BOVIN Uncharacterized protein (Fragment)
QALSFGHLPGKLLSLILPGMGVQSPGSTHRWVLPRWVQGAASGPWSHRIHRRTPPGSRVGSGQVSRVPGRTRGSQAG
Molecular weight: 8.17 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
20,055 |
4,425 |
24,480 |
10,724,545 |
8 |
34,340 |
534.8 |
59.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.08 |
2.27 |
4.75 |
6.98 |
3.77 |
6.55 |
2.57 |
4.37 |
5.64 |
10.17 |
2.13 |
3.52 |
4.67 |
6.27 |
5.69 |
8.24 |
5.26 |
6.14 |
1.22 |
2.7 |
Note: For statistics only major isoforms were used (in this case 20,055 proteins)
For dipeptide frequency statistics click
here