Torque teno tupaia virus (isolate Tbc-TTV14)
Average proteome isoelectric point is 6.91
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q91PQ2|ORF2_TTVD1 Uncharacterized ORF2 protein
MDPAKIWWHSCLLSHKSWCNCTEPRNHLPGWPTSEGTSTEDGDIITDAEMLTLAEDTEG
Molecular weight: 6.62 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q91PQ1|CAPSD_TTVD1 Capsid protein
MAYFRRNFYGGRRHYYRRRNAYTRRRYRRVRRRHRGRRFPYFKQGKRRRTRLLHVTDPRYKAHCTITGWVPIAMTRIQLISQPFTVDTLSPFHVYPGGYGYGVFTLEAMYKEHLMKRNRWSRSNAGFDLGRYLGTWLTLVPHPYFSYLFYYDPEYGNTFEFKKLIHPAIMITHPKTILVLSNKRGGNRRK
WPRMWIPRPAIFADGWEFQKDLCQHGLFAFGWAWVDLDRPWMADISKPAQTIDPSTYDKKNDMINKVPNMWWKEAANDWLTEWGRPQGSGVTQQFNQLAMAGPFVLKTNKSEYVNTELLQIILFYKSHFQWGGEFLQDKVLADPTKIPPAQTAYYQQAGQTNLYGSPYKPLSSGLHDSISELPIASPPQN
PHKYTVRPSDYDKDGILTEESFRRLTDSPYTSDGGHSFSSFSTASDPLEGTSRYARPLGRKTTREPSRRRKRRRRSPSPEDEETAPIPPKSNSEPSISGPGRATRKQLLQRLFRRLLTSSPQ
Molecular weight: 58.83 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3 |
0 |
3 |
775 |
59 |
502 |
258.3 |
29.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.94 |
1.16 |
5.68 |
4.77 |
3.61 |
5.81 |
3.48 |
3.87 |
5.03 |
8.0 |
2.19 |
3.23 |
3.87 |
8.39 |
9.16 |
8.0 |
8.26 |
2.32 |
2.97 |
4.26 |
Note: For statistics only major isoforms were used (in this case 3 proteins)
For dipeptide frequency statistics click
here