Ruegeria sp. (strain TM1040) (Silicibacter sp.)
Average proteome isoelectric point is 6.11
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,849 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q1GHK2|Q1GHK2_RUEST Serralysin
MLMLALIGSIAVIGAFVALDDDDDTEDTIPDNTETGTPGSDQLDGTDGRDLITLGDGDDSSFGGDGDDTIHGDAGADVLGGQIGGDDLYGGDGNDNLYGGAGDDFLSGGADADILEGGGSDDRMTGGGGLDVLLGGNGEDTLNGSLGQDLLYGGNDDDVLNGGYGADGLHGGNGEDTVSGGDGDDVINGG
ELLVDTSLTSASALREAFLDGENSPANLDFLFEDDKESDVLNGDAGSDLLVGGAGDVLNGGTGDDTFLVGDWLQAGEQVIIRDFDVEDEVVLYRYSGAAPDLDYNTVVNSDGSSDIEVTVNGEVVAYLENAGDGFDLASNVALVSA
Molecular weight: 33.72 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q1GJX0|RL34_RUEST 50S ribosomal protein L34
MKRTYQPSNLVRKRRHGFRARMATKAGRKILNARRARGRKSLSA
Molecular weight: 5.15 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,834 |
15 |
3,849 |
1,211,938 |
41 |
2,150 |
316.1 |
34.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.05 |
0.92 |
5.95 |
6.29 |
3.71 |
8.38 |
2.09 |
5.09 |
3.31 |
10.11 |
2.79 |
2.66 |
3.47 |
4.9 |
6.51 |
5.53 |
5.47 |
7.14 |
1.37 |
2.27 |
Note: For statistics only major isoforms were used (in this case 3,834 proteins)
For dipeptide frequency statistics click
here