Nannochloropsis gaditana
Average proteome isoelectric point is 7.34
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 10,819 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|W7TKF0|W7TKF0_9STRA Uncharacterized protein (Fragment)
EEEEEEEEDEDEDEDEDEDEDEIEDEIEEEEEDEDEDEEEEEEEEEDEDEEEDEVEDEDEDEDEDEDEDEIEEEEKDEDVIGEVDWDDDMTQAQDDDLTDDDDYEESMAALQAAEKEGALSSILPVGSTVPEGEEEAGASVLPVQDTEMKEDEEASAGVLPVTPVEDAVAPEASESQVATPPSPMRTPRP
TNAVPLPEASGDKEAPEAIAEGGGLPGGNGGAGNGGGMPNLGGIGNGPVGEMVKEGASNLVEGSSPMAGTEGEAGSESNPMSGAEEEALVEDANAREAESEATTTTTEILPPQADADPSAQSNVKEVLPVEDTVPADGTTGEETVVHSGAGLARTSGLVLAATLVLALVPALAL
Molecular weight: 38.23 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|W7TI67|W7TI67_9STRA Uncharacterized protein (Fragment)
MTLKLTRRRWPLMTMSRTMTLKLTRRLWPLMTMSRTMTLKLTRRRWPPMTMSRTMTSKLTRRRWPLMTMSRTMTSKLTRRRWPLMTMSRTMTLKLTRRRWPPMTMSRMRSRMMTRRAGMKCTTKRRRLWPPMTMSRMRSRMMTKRAGMKCTTKRRRLWPPMTMSRTRSRMMTRRAGMKCTTKRRRLWPPM
TMSRTRSRMMTRRAGMKCTTKRRRR
Molecular weight: 26.71 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
10,412 |
407 |
10,819 |
4,272,881 |
29 |
5,587 |
410.4 |
45.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.3 |
1.62 |
4.67 |
6.86 |
3.49 |
8.54 |
2.47 |
3.53 |
4.46 |
9.85 |
2.28 |
2.64 |
3.71 |
6.01 |
7.26 |
7.97 |
5.14 |
6.63 |
1.31 |
2.25 |
Note: For statistics only major isoforms were used (in this case 10,412 proteins)
For dipeptide frequency statistics click
here