Firmicutes bacterium CAG:631
Average proteome isoelectric point is 6.79
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,348 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|R5VW49|R5VW49_9FIRM Uncharacterized protein
MEFIGTHTGTLSQGTFNGETAITIEITADTITVNGVEATITAYDAYEGFTLTIDGNVYYLMNGDYSGGVSLAFMSEDYSIIGSGFIKDSTGEEPGGEDPDPSVTIPTEFIGTHTGTLSQGTFNGETAITIEITADTITVNGVEATITAYDAYEGFTLTIDGNVYYLMNGDYSGGVSLAFMSEDYSIIGSG
FIKDSTGEEPGGEDPEPSVTIPAEYIGIFSGELTSGTFYDETAIEITITASTITINGKEATITAYDETEGFTLMIDDVEFYLYNMDYDGGLVLAFMSADYEITGLDITKDSTSEEPVAGDALQGTWEDDNGNVFYFDGQGAGYYNNGESYDFTYSINDNTVSIEFASSFQYEVTITIQEDGTFSAYFDDY
DYPFTLIFTKQ
Molecular weight: 42.22 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|R5VPU0|R5VPU0_9FIRM 50S ribosomal protein L34
MKRTYQPSKRKHKNVHGFRARMATPNGRKVIARRRRRNRQVLSA
Molecular weight: 5.32 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,345 |
3 |
1,348 |
425,580 |
30 |
2,699 |
316.4 |
36.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.49 |
1.31 |
5.43 |
6.74 |
4.96 |
5.33 |
2.01 |
9.1 |
8.39 |
9.73 |
2.39 |
5.76 |
4.3 |
2.93 |
2.91 |
6.08 |
5.41 |
6.06 |
0.71 |
4.95 |
Note: For statistics only major isoforms were used (in this case 1,345 proteins)
For dipeptide frequency statistics click
here