Frigoribacterium sp. RIT-PI-h
Average proteome isoelectric point is 6.26
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,815 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0N1CPK2|A0A0N1CPK2_9MICO Uncharacterized protein (Fragment)
MNTYVSRGLMGALFVGGIWALGTTAANAATTTGDDGLLSGTQVGAVVEAPVSALGTAVSVLGDSSSTAAAPAAPAAAPAVPAAAPAAPAAPAAPVTTTSGDSGVLSGTQGIVSVDVPVAVGGNAVSVLGDSATAAPVAAPAPAAPVAPAAPAPSTTSGDDSIGSGTQGLVDVTLPVAVGGNAISVLGDSA
STGTSTEAPAGGAADAVPAGSATGTTSGDDGILGGTQVVPSVGLPVTVGGNAISVVGDSASSGTTTGTGTTGTTGTTG
Molecular weight: 23.98 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0N0KW54|A0A0N0KW54_9MICO Uncharacterized protein
MRGPAPRGRRGRARPRAASRAAGNGAVLGRTPRRRPRRPRRASTRRDRSAPARPSARARTRRRGRPGGVRRRAGRSGPGRGGAAAGGGWGSWS
Molecular weight: 9.95 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,798 |
17 |
2,815 |
838,641 |
40 |
3,016 |
299.7 |
31.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.17 |
0.45 |
6.65 |
5.19 |
3.03 |
9.32 |
1.91 |
3.68 |
1.94 |
9.93 |
1.63 |
1.76 |
2.77 |
5.57 |
7.25 |
5.98 |
6.52 |
9.98 |
1.39 |
1.88 |
Note: For statistics only major isoforms were used (in this case 2,798 proteins)
For dipeptide frequency statistics click
here