Virtual 2D-PAGE plot for 1,221 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A0G0RL29|A0A0G0RL29_9BACT Type II secretion system F domain protein (Fragment)
QMVEVGEETGETSQVLEQLAVFLEEEVANTTKNMASLIEPLLMLAVGGAVGFFAISMIQPMYSMLEAIQ
Molecular weight: 7.48 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0G0RPN0|A0A0G0RPN0_9BACT Uncharacterized protein
MPGSVRVRLRERQRRGRQRHVAGRRQRCEQHRGVGPGPVLLRRGLQLRQAVRSRRGRVRGPGVRRLPLRGGLRRRVLHRDERGRNRRHDQGRRQLPAGRRHHGVLPPAAVRVHALHGRARARRPRGAAGGVLLHHLLLGREPGQHRQDGELRRRRPESERVRGVPLEHPDGRARVWHQHQVLRRRQRHAW LLDEADAGRGRERSVARRHRAEELHHQQRVYGAWLHGRPRLRLRPLRRRQRRRDVGFLPRVARKERQVRFSLPGRRAVIKLRTDQLGHPVLSVTCCKP
Molecular weight: 33.92 kDa Isoelectric point according different methods: