Acanthamoeba polyphaga mimivirus (APMV)
Average proteome isoelectric point is 6.73
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 909 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q5UQ81|YR514_MIMIV Uncharacterized protein R514
MNKVNINFSLKSLPTDLLNHMNYYDNGSTNVKCTLQSFKNTLEHNLLLINKLIEESENITNVLCHPNNILLEFNSNNVMNKLINDGTVKIINDNYDGTDDDLIPLVDLSEEETNQDRLNRIINMTNRDNSGGLFGASDDDEEEISDDDLLLHDLLGNQNDTSSIFNKYTNLIGNVIDNSDNSSDSDDSDS
LDGSDDLNDSDNVDNLFVG
Molecular weight: 23.35 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q5UNW3|YR705_MIMIV Uncharacterized protein R705
MSRNGRNDYDYDDDYDNDQMGGRLARDRERDSEGYLYTKTGERNRRSGPEARERNRENALNRSRNDGRFAPERGGRGYGDDDVKYTKSGRVNGRTTREARERNSRTARSEERDELGRFIGKRGSSRATRGTYTEGANDAAQLLLGGKQGVAENPETDERHSDAFRMEHRRLAEERERDEFGRFLPTEDGE
DGRRGRRSNSRRRSSNARSTSSRSSGSRSSGSRSSGSRSSGSRSTGSKTSSRSSGSKTSRSSGSSRSRSGSSGSKSGRSRNSRSGTSGRSSNSRSGSRSGSSSRSSNSRSGSRSSSRSGSSRR
Molecular weight: 34.45 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
909 |
0 |
909 |
341,649 |
81 |
2,959 |
375.9 |
43.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
3.07 |
1.8 |
6.8 |
5.49 |
4.62 |
4.64 |
2.05 |
9.86 |
8.98 |
8.16 |
2.12 |
8.88 |
3.14 |
3.22 |
3.29 |
7.38 |
5.25 |
5.05 |
0.74 |
5.44 |
Note: For statistics only major isoforms were used (in this case 909 proteins)
For dipeptide frequency statistics click
here