Plasmodium vivax (strain Salvador I)
Average proteome isoelectric point is 7.18
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 5,389 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A5KDU8|A5KDU8_PLAVS Uncharacterized protein
MKNTVCLIFCLFFLNQFSCGDREETVDAVPNVGVLNLEKPTLRALLAENPGGVSEGVDNEEVASEEVANEDVVSDDLPVDSVAAEEVPPEVVPLEEVSTEEVPSEEDPSEEDPSEEDPSDDAPSAPSAPAAEEQNQEAEEVPPAANAEPSDDSPVEVVDGEDSVVEEEEGQHVEQDVPAVQEEEGQEEAH
QESCSDCSAPCSPGATECESKCSENCNCDGACPEDCAVDEGCEAVDCSEGSDGSDGPACDACQKESEDEQPEEGVDAAAGVSSEVEQQAEQGVAPLAVEEDSEGDEPENEEDSDGEETDDVLSEIFRGLRNVADKEETVLEENEEAAGEQAVDENGQQQEGEAYEGEGAGEAAPGEDGEEVAEGQNAEAP
SSDTSSNDSGIGSVTTETENLVDDLMNLLNSDNGVDQSLKVLAQDMAQYFLNHLNAESEVA
Molecular weight: 46.35 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A5K5R3|A5K5R3_PLAVS Uncharacterized protein
MVLLKKKLLLRKPLLKRLLRKPLLKRLLRKPLLKRLLKKLLKNVPKKRSL
Molecular weight: 6.09 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,389 |
0 |
5,389 |
3,748,164 |
39 |
11,429 |
695.5 |
78.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.26 |
1.84 |
5.48 |
7.71 |
4.27 |
6.59 |
2.72 |
5.6 |
9.02 |
8.21 |
2.02 |
7.24 |
3.28 |
3.61 |
4.9 |
8.08 |
4.3 |
5.24 |
0.62 |
4.02 |
Note: For statistics only major isoforms were used (in this case 5,389 proteins)
For dipeptide frequency statistics click
here