Shinella sp. DD12
Average proteome isoelectric point is 6.64
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 7,319 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A021X3G0|A0A021X3G0_9RHIZ Hemolysin-type calcium-binding repeat-containing protein
MSDTYFLTAGDDTFVFENRQGSVFAQGGNDSVLGNDGANRIGLGTGNDVAQAGGGNDVIWGNAGNDEIDGGAGNDTLFHGAGDDIVRGGSGNDIVYGGPGISPNSGRDDIDGGAGNDTIYAGDMNDTLRGGEGDDLIGGGDGDDVIYMDGNDTVYGGNGEDTAYLDGNAGDYLLTLNGSGLFEISGNGDK
QAVFGVEKIVTANGVINLDLDLSNLVGAGLGDVLNEVGLNGLLDTLLGENIGDGGLHLDDLVDGVVDLADLGLTQSLLDDLLGPGGVLDDLLGIL
Molecular weight: 28.58 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A021X3F6|A0A021X3F6_9RHIZ Uncharacterized protein
MSSFLTFMTLLVMGLVAIVLVRGLVNMAKGGSGNTSNKLMQLRVLLQAIAIVLIMLTLWITGGGR
Molecular weight: 6.93 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
6,510 |
809 |
7,319 |
1,935,936 |
25 |
2,867 |
297.4 |
32.3 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.53 |
0.83 |
5.65 |
5.81 |
3.92 |
8.49 |
2.01 |
5.39 |
3.5 |
10.12 |
2.53 |
2.64 |
2.87 |
4.88 |
6.95 |
5.45 |
5.42 |
7.42 |
1.3 |
2.28 |
Note: For statistics only major isoforms were used (in this case 6,510 proteins)
For dipeptide frequency statistics click
here