Banna virus (strain Indonesia/JKT-6423/1980) (BAV)
Average proteome isoelectric point is 6.36
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 12 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|Q9YWQ0|NS3_BAVJK Non-structural protein 3
MNNGQATITRNGGRFEIRCRHLDRDYTMPLPNATSNDNFLDCIKFITECVGFDYVSSGFKLIANVNDFQHLNGNSTLLIGKTKIGPLILKKVRSLPCCNDALFRNEFRILAKMHGILRLKNDVNGHKYGIILERCYKPKINFSNFVTAINDLDVFHSSNQHLLHGDANPDNIMSDSEGYLKLVDPVCLLE
NQVNMVNIEYESLTQEAEKKVFINSLLQLVEKQMSATIDEIYVNLKEVNPSFNLEHGLKLSDLLDNIDVYNSDHWKLMLNHRPMMPELSVLNDLTYYDTGEVRDLVTEDLDDEDDV
Molecular weight: 34.99 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q9YWQ2|VP10_BAVJK Structural protein VP10
MDVLSKSSLKELLAHLERTPLEEAISYKIGTIPYQNVLISRNEYYNQPYPDVTSLIDGVAREGQRNVNGLIMSIISYVVSGSGHYIPNIGYTLLRRSILDILTKHDTGLNTNNINYDMIARNLTVSKMNCEQRKRMLICFKLLAYKDGNLNDYETYLNQNISLKQIAPNFIPGDMRTVMSNSDKLSIVGI
PAYRLTQSTELSIRDDNAKSYKIGYVDWYNSSSFLREGNDFNLISLKDRDNKYVRLNGW
Molecular weight: 28.52 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
12 |
0 |
12 |
5,924 |
180 |
1,214 |
493.7 |
55.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.31 |
1.27 |
6.6 |
5.33 |
3.76 |
5.38 |
2.3 |
6.77 |
6.62 |
9.22 |
2.68 |
6.77 |
3.02 |
3.31 |
4.69 |
7.36 |
5.81 |
7.92 |
0.61 |
4.27 |
Note: For statistics only major isoforms were used (in this case 12 proteins)
For dipeptide frequency statistics click
here