Candidatus Curtissbacteria bacterium GW2011_GWA1_40_16
Average proteome isoelectric point is 7.54
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,037 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G0TUU0|A0A0G0TUU0_9BACT Uncharacterized protein (Fragment)
TDSASQTTDPTPTPEPDPSPSATDGTASEPTPAPTTESLSVDPSPSPDPSPSPSPAPCETGCEGEVSQTNDAQVTNEVSATSDTGNNTIGDTPETLSDTQSNETTQSAEDESSEASDPSANNNAEGVAVTTGDAAVSVEVVNEVNTNIADSSYSLEVKNLYLDENGNVDFSQLGDLGQLPSALVFVRDQN
NNATVVNLIYASANTGQNSVLGTGDVQTGNAYVSVNLLNFINSNFAGSTLQFVVFNIFGNLNGNIVLPDNFGLAAGESQSRQFQYFRREFCGAYYQ
Molecular weight: 29.79 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0RFR7|A0A0G0RFR7_9BACT 50S ribosomal protein L16 (Fragment)
MLAPKRAKYRKQFRNRRNGLAVRGSSLSFGSHGLKSQETAWITARQIEAARRAMTHYTKRGGRIWIRIFPDKPVTKKPAETR
Molecular weight: 9.5 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,020 |
17 |
1,037 |
280,667 |
23 |
2,371 |
275.2 |
30.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.38 |
0.66 |
4.96 |
5.79 |
5.33 |
6.71 |
1.59 |
7.82 |
7.82 |
9.81 |
1.81 |
4.58 |
3.49 |
4.19 |
4.22 |
6.72 |
5.53 |
6.89 |
1.16 |
3.54 |
Note: For statistics only major isoforms were used (in this case 1,020 proteins)
For dipeptide frequency statistics click
here