Methanobacterium paludis (strain DSM 25820 / JCM 18151 / SWAN1)
Average proteome isoelectric point is 6.35
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,394 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F6D352|F6D352_METPW Parallel beta-helix repeat protein
MRKNVRKQAATIMLVFAFALIICGAVSAADTPTTTNSGSSTLSSAASSTPTTDVSTSRSDGISRSDNNKIENNFIFANGNNGISVSDSEDTNIEDNTIFANGDNGISVSDSEDTNIEDNTVTGNGDNGINVEDSTFTNIEDNNVIANGDSGNGINVEDSAFTNIEDNTVIANEDNGINVEDSLFTNIEDN
TVIGNGDNGINVEDSAFTNIEDNFIFANEDNGINVEDSAFTEIEDNTVIGNGDNGINVEDSAFTEIEDNTVIGNGDNGINVEDSAFTEIEDNFIFANEDNGINVEDSLFTNIEDNNVIGNGDNGINVEDSAFTNIEDNFIFANEDNGINVEDSLFTNIEDNFIFANEDNGINVEDSLFTNIEDNNVIGNG
DNGINVEDSLFTNIEDNNVIGNGDNGINVEDSAFTNIEDNFIFANEDDGISLEDSLFTNIEDNFIFANEDDGISLEDSAFTNIEDNFIFANEDDGISLYGSNFNLIADNFIFANEDNGISLYGSNFNAILLNNIFANEDNGISLYGSNFNAILLNNIFANEDNGISLYGSDDNAILLNNIFANGHDGIGI
YGSEALIFANGDDEVNVRSDDNQIGKEFIFGNRNDGISVYRTDGTEIEEKFIFANGDDGVGVYRSDDTEIENCFIFANENDGVSVYGSDDTKIKNSFIFANEDDGVSVYGSDDTEIKNSFIFANEDEGVLV
Molecular weight: 75.6 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F6D5B6|F6D5B6_METPW 50S ribosomal protein L39e
MSRHKPLAKKLRLAKAGKQNRRVPLWVMLKTSRKVRVHPKMRQWRRNKIKP
Molecular weight: 6.24 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,377 |
17 |
2,394 |
657,047 |
30 |
2,342 |
276.4 |
30.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.41 |
1.21 |
5.67 |
7.17 |
4.17 |
7.18 |
1.7 |
8.72 |
7.89 |
9.0 |
2.8 |
5.14 |
2.34 |
3.7 |
3.64 |
6.23 |
5.47 |
7.33 |
0.85 |
3.38 |
Note: For statistics only major isoforms were used (in this case 2,377 proteins)
For dipeptide frequency statistics click
here