Sulfurimonas gotlandica (strain DSM 19862 / JCM 16533 / GD1)
Average proteome isoelectric point is 6.3
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,865 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|B6BI92|B6BI92_SULGG Uncharacterized protein
MNILLLNDNPVVTKLVTLSAQKTSDELDIVSSVEEVEAGTYELFVLDDTLYSEEILNEIKEKVKFSKSLYICSRDAQEVEGFTATLRKPFLPTDLVELFASLGKDATTIDLGTDEEELDLTDSLEEVIDDSELLELADDDIEELGELGDIDDLDDLDDMDMDLDSELGEELNLEEDAEELDGLSLDDEEE
DLDDMDLDLGDISLEDDEEIDELSLDDIDLGESVLDKDELQEVQDLLEETEDNTEELFSDNINDEELDDMDLGDLDLEDDLDIDDLSLDDEDNKKSVDDAISDELENIEEDLDLDMDLGDDTDLDDLSLDDDLDLDGLSLDDDETEEEVKKASPEELPEDEISDEDESLDEMDLGDLDLDDDDDDLNIDD
LSLDDEEESLEEVNTDELDEAEENNEEEESLESEAIAEELDFEDELDISDDLEAEEEFNIDDISDEELESKIESAVLELSDEDLESELDEDTLLDIAVSDINGLESLNTRDIKLAIGEEVGDEEVNTDELDEVEITEDVDLEELGEVETISKDTEITPDNDGVESLKKLLAALSNEDVVASMKGMKININ
ITLGDK
Molecular weight: 64.46 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|B6BIR2|B6BIR2_SULGG 50S ribosomal protein L34
MKRTYQPHSTPRKRTHGFRLRMSTKNGRRIINRRRAKGRKRLSV
Molecular weight: 5.39 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,863 |
2 |
2,865 |
912,281 |
37 |
2,504 |
318.6 |
36.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.6 |
0.82 |
6.14 |
7.1 |
4.81 |
5.65 |
1.94 |
8.75 |
8.4 |
9.54 |
2.68 |
5.5 |
2.88 |
2.73 |
3.32 |
7.08 |
5.19 |
6.21 |
0.72 |
3.96 |
Note: For statistics only major isoforms were used (in this case 2,863 proteins)
For dipeptide frequency statistics click
here