Rhodobacteraceae bacterium HTCC2150
Average proteome isoelectric point is 6.26
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,636 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A3JMM0|A3JMM0_9RHOB Uncharacterized protein
MPFFFDWSAYSDPNGTFTLNDGSEDLDVTVSAGSNQFIANMAGNDVLKSYEQTGPVSTTIGFDQVVQGVSFEIFDVDQGTDIEGWQGIGSGGWDDAITITAFDEAGNEIQIPASAITLTTHHSVTSTPTGTTIDSGGADTPNLEGTGAADTVLVTIDFPVASIQITHNVGDNGATSTGTIGVSDITIDTI
VDPVDPAGPVDGEETSEAMILGYDDALGATDGGGDMITTGNDSILGNGGDDFIDGDAGDDTIDGGQGDDTIQLSDNFGDDTIAGDEDICNQDIDTLSGEGITGEGVTVTFSGDESGTLTGNTSGDEADFIEIEKVVTTDQDDTIDGTGSPNGIDVDAGDGDDTITGGTGGDTIDGGNGNDDIDAGEGDDV
LKVGGRGQYP
Molecular weight: 39.47 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A3JN73|A3JN73_9RHOB 50S ribosomal protein L34
MKRTYQPSNLVRKRRHGFRSRMATKAGRKILNSRRSQGRKSLSA
Molecular weight: 5.17 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,612 |
24 |
3,636 |
1,077,811 |
20 |
11,732 |
298.4 |
32.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
10.79 |
0.95 |
6.11 |
5.75 |
4.19 |
8.19 |
2.06 |
5.97 |
4.37 |
9.62 |
2.95 |
3.62 |
3.34 |
4.46 |
5.47 |
5.76 |
5.61 |
7.07 |
1.35 |
2.36 |
Note: For statistics only major isoforms were used (in this case 3,612 proteins)
For dipeptide frequency statistics click
here