Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Average proteome isoelectric point is 6.55
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,263 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q6F7V0|Q6F7V0_ACIAD Uncharacterized protein
MLLKSLVSSISKVTQDLGNVISTQSALSSEGSLQLSLTLSATANSLINNLTSSSSTIKTIIDGLTDNLHSTPLETVTDLLGGLTGGISTGDNPLSAITTPLQTGIDVLQGVESLKTDVINSAIDTLADAGISILPQAEHQISTLADLGTLTFETSRDTVNGTLDAVSAVVDLNPQGVSTALTGVVGTLVE
NGSTAANLLSGLSGGLEGNPLETVTDLLGGITGGANGNPLEAVTDLLGGVTGGTNGNPIETITDLLGELTSGINTGDNPLATITAPLQSGIDVLQGIESLKTDVINSAIDTLADAGISILPQAEHQISTLADLGTLTFETSRDTVNGTLDAVSAVVDLNPQGVSTALTGVVGTLVENGSTAANLLSGLSG
GLEGNPLETVTDLLGGITGGTNGNPLEAVTDLLGGLTGGTNVNPIETITDLLGELTSGINTGDNPLAAITAPLQTGIDVLQGVESLKTDVINSTIDTLADAGISILPQAEHQISTLADLGTLTFETSRDTVNGTLDAVSAVVDLNPQGVSTALTGVVGTLVENGSTAANLLSGLSGGLEGNPLETVTDLL
GGLTGNVDTGLLDDLTGSFHGLIDIGETLVLDSTEIVADASHALLNTFESAADSTVNLVSSLLDSVTLSTEGANSQLGVVNDLLSNLTSSLSNVSHTYQVPISVPNVLDQLLENQLSTV
Molecular weight: 69.0 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q6F6K7|RL34_ACIAD 50S ribosomal protein L34
MKRTFQPSELKRKRVHGFRARMATKAGRQVLARRRAKGRHSLTV
Molecular weight: 5.18 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,230 |
33 |
3,263 |
1,032,820 |
23 |
3,711 |
319.8 |
35.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.45 |
0.95 |
5.2 |
5.56 |
4.3 |
6.59 |
2.55 |
7.03 |
5.29 |
10.55 |
2.51 |
4.35 |
5.62 |
3.97 |
4.39 |
6.24 |
5.35 |
6.55 |
1.28 |
3.28 |
Note: For statistics only major isoforms were used (in this case 3,230 proteins)
For dipeptide frequency statistics click
here