Parcubacteria group bacterium GW2011_GWA2_45_30
Average proteome isoelectric point is 7.35
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 769 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1Q8L7|A0A0G1Q8L7_9BACT Uncharacterized protein
MFFNPRIEKKYRNYKKISWLLIASIVIMQSVVFIPLANAIETIELDASQFQQSEGGGSDSTGAAGTTEETGSETTGSTESTTGTGSSGTSGTDNSSAGTGGTSAGGTDAAGTASGGTSATGESTAGTTGETGFGGLVDSAWGAVTGPGTALGEALGALGLSDTPGLGTPGGMGFAAAGLAASAFGGPIGT
GIAAVAAIANYACGGCIVGFINSLFEDPIPDLGFLGTFDELIDTIDEQLGLSQEELDEISGNPPGGFDEMMSGMMDELADEIDAIGEVGGSTADSVGTGTGMGSSADSFGGTGGTTGSVGGTDNVGTDAPGPGGFEGFQDVATEDLQDFADVADSATEAAGATEGYGDDIDSNDLEGYDEDATEAAEAEA
EAEAESESDSDSDSEGTEGDDNEDGDAEGEGGEEEEEEEEEEEEEE
Molecular weight: 41.98 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1PG76|A0A0G1PG76_9BACT Uncharacterized protein
MIRSVIRYLNILCIATRFGLSSGGLTKGRSDFLRLGRRTKQIRPPIVALHKISRSHRSLTGLLNVSASGGNQQ
Molecular weight: 8.05 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
769 |
0 |
769 |
216,733 |
21 |
2,241 |
281.8 |
31.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.02 |
0.85 |
4.89 |
7.15 |
4.95 |
7.2 |
1.86 |
7.68 |
6.93 |
9.4 |
2.17 |
3.92 |
2.99 |
4.4 |
5.78 |
6.13 |
4.97 |
6.4 |
1.16 |
3.13 |
Note: For statistics only major isoforms were used (in this case 769 proteins)
For dipeptide frequency statistics click
here