Virtual 2D-PAGE plot for 6,698 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|K0KMQ4|K0KMQ4_WICCF Uncharacterized protein
MIHDSLDDSEEDGISDELEADSDDDETSEELETSDDDENSDDDDSIEELDTSDDDETSDDEEDDSIEELEASEELETSEEEDDSTEDETSDEDDDSIEELEASDDDDSIEEELGIEELGTSEGIDEDSELDEVITELELEDEEELSLAGQLEPGTFTISVTVPSLPVANEVVAVHSVKV
Molecular weight: 19.68 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|K0KFP7|K0KFP7_WICCF Uncharacterized protein
MRSLPPPRKSKARAFRRLLHKLYKILTLQFLLKSQKGIVVRKRRTPFHFTSRKYKVKLPKNRRYRSNYNWFKKSKYHRRGIPISQIALGEDNLLDDNGNGVSIQQVQFRSYRRRHGLSRADRKVLRRLFKKMIYKMYAPRRHRNMKNLNIVVDI
Molecular weight: 18.76 kDa Isoelectric point according different methods: