Mycoplasma pulmonis (strain UAB CTIP)
Average proteome isoelectric point is 7.84
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 778 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q98Q42|Q98Q42_MYCPU LIPOPROTEIN VSAG (Fragment)
SGNNSGTKEKKPNKSPNNDQGSNGSDGNQKLNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAP
GGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGDTMTNPPAPGGD
TMTNPPAPGGDTMTNPPAPGGDTMTNPPNPPAPGGDTMTNPPAPGGDTMK
Molecular weight: 40.95 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q98PM6|RL28_MYCPU 50S ribosomal protein L28
MSRRDDLTGKGPMFGNNRSHALNATRRRFNLNLQKVSVVVNGRKVNLKVSAKTAKTLRRKNLI
Molecular weight: 7.15 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
778 |
0 |
778 |
288,921 |
37 |
3,216 |
371.4 |
42.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.69 |
0.3 |
5.35 |
6.89 |
6.1 |
4.5 |
1.41 |
9.48 |
11.0 |
9.57 |
1.6 |
7.62 |
3.68 |
2.71 |
2.83 |
7.6 |
4.67 |
5.3 |
0.95 |
3.74 |
Note: For statistics only major isoforms were used (in this case 778 proteins)
For dipeptide frequency statistics click
here