Trypanosoma vivax (strain Y486)
Average proteome isoelectric point is 7.87
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,778 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|F9WP60|F9WP60_TRYVY Cellulosomal scaffoldin anchoring protein putative (Fragment)
MSLVPLENMMIYNYIVICEVQDSISTTTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTKTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTT
TTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTTSEPTTTTT
Molecular weight: 24.93 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|F9WSZ0|F9WSZ0_TRYVY Putative uncharacterized protein (Fragment)
MPRATRVTRTPRATRVIRTPRATRVSRMPRATRVIRTPRATRVTRMPRATRVIRTPRATRVTRMPRATRVTRMPRATRVIRTPRATRVTRTPRATRVTRTPRATRVTRTPRATRVTRTPRATRVTRTPRATRAIRTPRATRVTRMPRATRVTRTPRATRVIRTPRATRVTRMPRATRVTRTPRATRVIRT
PRATRVTRTPRATRVTRMPRATRVTRMPRATRVTRTPRATRVTRTPRATRVTRMPRATRVTRTPRATRVSRTPRATRVTRTPRATRVIRTPRATRVIRTPRATRVTRTPRATRVTRTPRATRVTRTPRATRVTRTPRATRVTRTPRATRVTRTPRATRVTRTPRATRVIRTPRATRVTRTPRATRVTRTP
RATRATRTPRATRVTRTPRATKVTRTPRATRVIR
Molecular weight: 48.14 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,778 |
0 |
3,778 |
1,476,553 |
8 |
4,061 |
390.8 |
42.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.31 |
2.52 |
4.52 |
6.41 |
2.59 |
6.93 |
2.72 |
3.04 |
5.46 |
8.36 |
1.99 |
3.63 |
3.98 |
4.0 |
7.9 |
7.43 |
6.86 |
6.64 |
1.27 |
1.47 |
Note: For statistics only major isoforms were used (in this case 3,778 proteins)
For dipeptide frequency statistics click
here