Oxobacter pfennigii
Taxonomy: cellular organisms; Bacteria; Terrabacteria group; Firmicutes; Clostridia; Clostridiales; Clostridiaceae; Oxobacter
Average proteome isoelectric point is 6.46
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 4,273 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|A0A0P8X2B0|A0A0P8X2B0_9CLOT UPF0473 protein OXPF_14280
MENEAENIITLLDDEGNEVECEVIDMFEFEEKEYIVLLPADEEDPYILRVDKDEDGSEIFAVIEDDEEFEKVADAYDELLEEDEN
MENEAENIITLLDDEGNEVECEVIDMFEFEEKEYIVLLPADEEDPYILRVDKDEDGSEIFAVIEDDEEFEKVADAYDELLEEDEN
Molecular weight: 9.96 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0N8NTL7|A0A0N8NTL7_9CLOT Uncharacterized protein
MLLVLPVRLALPATQVLLALLVLPARLALPATQVLLALLVLPATQVLLALLVLPATQVLLAPLVLPAQLALPVTQVLLALLVLPARLALPATQVLLALLVLPARLALPVTQVLLALLVLPARLALPVTQVLLALLVLPARLALPATQVLLALLVLPARLALPATQVLLALLALPAQLALPATRVLLALLV
LPARLALPATQVLLALLVLPARLALPATRVLLALLALPARLALPVTRVLLALLALPARLALPVLLLLVLSFPLQVDLSPR
MLLVLPVRLALPATQVLLALLVLPARLALPATQVLLALLVLPATQVLLALLVLPATQVLLAPLVLPAQLALPVTQVLLALLVLPARLALPATQVLLALLVLPARLALPVTQVLLALLVLPARLALPVTQVLLALLVLPARLALPATQVLLALLVLPARLALPATQVLLALLALPAQLALPATRVLLALLV
LPARLALPATQVLLALLVLPARLALPATRVLLALLALPARLALPVTRVLLALLALPARLALPVLLLLVLSFPLQVDLSPR
Molecular weight: 28.1 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
0 |
1,282,805 |
30 |
3,275 |
300.2 |
33.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
6.88 |
1.17 |
5.62 |
6.93 |
4.3 |
6.95 |
1.51 |
9.1 |
7.69 |
9.13 |
2.92 |
5.11 |
2.62 |
3.37 |
3.9 |
6.36 |
5.04 |
6.5 |
0.82 |
4.08 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |