Actinobacteria bacterium OV450
Taxonomy: cellular organisms; Bacteria; Terrabacteria group; Actinobacteria; Actinobacteria; unclassified Actinobacteria (class); unclassified Actinobacteria (class) (miscellaneous)
Average proteome isoelectric point is 6.82
Get precalculated fractions of proteins
Virtual 2D-PAGE plot for 8,446 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:
>tr|A0A0N1H1D3|A0A0N1H1D3_9ACTN Uncharacterized protein
MSEFSSTTGSDLDLDLDLDLSDLTVTALSDTAALPENGGSWGSCSCQGSSSCAQPQVETPVV
MSEFSSTTGSDLDLDLDLDLSDLTVTALSDTAALPENGGSWGSCSCQGSSSCAQPQVETPVV
Molecular weight: 6.3 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0N1FKW0|A0A0N1FKW0_9ACTN Uncharacterized protein (Fragment)
RTRVAMTTVVAVLPTRVGMTIVVVSVVVVTTVVATVRRTRAVTTVVSAPRAAVSVVTTGASVPRTRVATTTVVAVLPTRVGMTTVVVSVAVVTTVVATARPTRAATTAVSAPRAAVSVATTGASVPRTRVVMTTVVGVLRTRVGMTTVVVSVAVVTTVVATARPTRAATTAAGTAAVMTVVATAVATVAA
AMTAAVTATTVRTATGTRSSGFRSTRTSPVWRSTPMSARSS
RTRVAMTTVVAVLPTRVGMTIVVVSVVVVTTVVATVRRTRAVTTVVSAPRAAVSVVTTGASVPRTRVATTTVVAVLPTRVGMTTVVVSVAVVTTVVATARPTRAATTAVSAPRAAVSVATTGASVPRTRVVMTTVVGVLRTRVGMTTVVVSVAVVTTVVATARPTRAATTAAGTAAVMTVVATAVATVAA
AMTAAVTATTVRTATGTRSSGFRSTRTSPVWRSTPMSARSS
Molecular weight: 23.14 kDa
Isoelectric point according different methods:
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
|---|---|---|---|---|---|---|---|
2,608,395 |
30 |
5,469 |
311.3 |
33.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
14.25 |
0.85 |
5.67 |
5.54 |
2.68 |
9.65 |
2.32 |
3.04 |
2.09 |
10.28 |
1.72 |
1.73 |
2.8 |
6.48 |
8.07 |
4.99 |
6.05 |
8.21 |
1.55 |
2.03 |
For dipeptide frequency statistics click here
See this proteome in:
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here
Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978  |
Contact: Lukasz P. Kozlowski |