Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Average proteome isoelectric point is 7.29
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 8,253 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q89CX2|Q89CX2_BRADU Bll7673 protein
MMGIKPNPKSATSMTGRNPTRVAHFHAKGAETMALINGTAGDDVLPGTAADDQINGLQGNDTITGLDGNDTVSGGPGNDNIDGGAGNDTLDGNAGIDTIAGGDGDDTINGGAGDDTLNGNAGVDTIHGNAGIDTIDGGTGDDHLFGDAGDDSIHGGDGNDDVHGGAGADTLWGDAGDDTLSGDAGNDVLN
GGDGNDVLNGGLGDDTLNGDAGNDTLNGGLGNDLLNGGMGDDILNGGAGADTLNGGDGIDTMHGDAGDDLMDGGGGNDVMFGDAGDDLMAGGAGNDTMSGGNGDDELSGGAGNDTLNGDAGDDTLAGGDGADVLNGGDGADSLSGGAGNDTLNGDAGDDELSGGNGADVLSGGLGDDVLTGGGGTDTHNF
GDGTATNFGNDEVTDLSAADGDVVHVDAPAGFDPATVVVDDDGTNTVLDFGFGTIQLDGVSGGATPFESIDDINNAAGYTAIEVV
Molecular weight: 44.38 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|Q89BQ2|RL34_BRADU 50S ribosomal protein L34
MKRTYQPSKLVRKRRHGFRARLATAGGRKVLAARRARGRKRLSA
Molecular weight: 5.09 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8,024 |
229 |
8,253 |
2,542,667 |
26 |
5,685 |
316.9 |
34.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.42 |
0.92 |
5.46 |
5.25 |
3.74 |
8.34 |
2.06 |
5.26 |
3.6 |
9.88 |
2.46 |
2.76 |
3.19 |
5.27 |
7.2 |
5.83 |
5.43 |
7.41 |
1.32 |
2.21 |
Note: For statistics only major isoforms were used (in this case 8,024 proteins)
For dipeptide frequency statistics click
here