Virtual 2D-PAGE plot for 1,687 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|Q8TXL7|Q8TXL7_METKA Uncharacterized protein
MGRDEGEDKFDGGDEGTSDEPDVPEIRLDGESDGPDHDHPEGPDSDSEPQYPQNILSHEGDHTDIDVSNTNISTAESDLEADLDSNSYSESSSESDATQYTAQYSDLDQDTDQIQDSRSESISDVESVQESSSESNPDVDVNVDNVVDVDDPADPGVIYDVDREVNVDDRDTYVEENVYYGDTDRTIYDP RTDSDTGSVDPSSDPTTAGDQVVVGSEDPYMVLDTQKGQVDVLVGEDPTTINMGQSELSQLLDLVNWLDGNAPSDVLDLLYQLLAYLLETFYGLIPLDNILNMIQQIAEYALSGELGLDVLNQLLGVLETATSPLYAATEILKFLGDLDLGLDALLDIDI
Molecular weight: 38.11 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>sp|Q8TUY3|RL39_METKA 50S ribosomal protein L39e
MARVKPLGKKLRMAKAIKQNRRVPPWVVAKTGGRVIDNPKRRHWRRSKLKP
Molecular weight: 6.01 kDa Isoelectric point according different methods: