Coraliomargarita akajimensis (strain DSM 45221 / IAM 15411 / JCM 23193 / KCTC 12865)
Average proteome isoelectric point is 5.93
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,110 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|D5EIR4|D5EIR4_CORAD Conserved repeat domain protein
MNKFIKDQSLGIYAAGFLALAAMTPGGLFAQTAPDTDVENTATVSYEIDGVDQPDESGSVTFEVDALVNPTVANTSGTDIVPDQQDAVLAFTVTNDGNQTQDFVLNIEQPTGDDANLSNVQVFIDANDNDSYDDGVDTLITPGSAAAADAVQDLAAGDSISVFVVGDVPDTLSDTDTIDVNLVAIAYDPG
ADNTTIGAIETETAVPAIDAVDTVFGDESGAFTGDTALNGEHSDTGTYTVGSVSIAVTKTAAVTDDGLDNGTTEQLYIPGATVTYTITIAYSGSASQTADAITLSDPLPDNTTFVANSILINGAAAVAPDTASYDGGTDTVTVTLDAGRAGDASNDVVTFEVTID
Molecular weight: 36.12 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|D5EMQ1|D5EMQ1_CORAD Uncharacterized protein
MGNLKKKRRLKMSKHKRRKRLKSNRHKKRTW
Molecular weight: 4.02 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,098 |
12 |
3,110 |
1,114,650 |
30 |
16,477 |
359.8 |
39.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.4 |
1.09 |
5.92 |
6.64 |
4.12 |
7.63 |
2.14 |
5.66 |
4.19 |
10.0 |
2.23 |
3.59 |
3.91 |
4.5 |
5.52 |
6.62 |
5.51 |
6.78 |
1.43 |
3.12 |
Note: For statistics only major isoforms were used (in this case 3,098 proteins)
For dipeptide frequency statistics click
here