Candidatus Levybacteria bacterium GW2011_GWA2_40_16
Average proteome isoelectric point is 7.21
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 854 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G0RCY8|A0A0G0RCY8_9BACT Uncharacterized protein
MNIFKKTILTGAATAALFVQTVLPAFAATTITISGNGSNSDNDADVEIERETTVVQENESDIENKIDVDANTGDNQANDNTGGDVEVETGDADVDVKVQNSTNTNVAEVNGCDCDQDAEVKIIGNGTHSENEVDLDLKYKTEIYQENDADVDNDVDVDANTGDNDADDNTGGDVKVTTGNSDVKVDLITL
ANSNLATKNGNGNGAGSISAMILDNGSYSDNDIDLELEREVLLDQDNDADVDNDVDVDSNTGDNDADDNTGGEVAIETGDSDVKVLVDNMSNFNAADLDCGCILDILAKIDGNGTDSENEIKAEFEDELETFQENDDETENEVDVDSDTGDNEAEDNTEGNQNGDPSIKTGNGGADVEVHNNSNTNQLGS
VDLEGLDWMGHDVNFTFDLNAFLMALLGL
Molecular weight: 43.34 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G0RKJ4|A0A0G0RKJ4_9BACT 50S ribosomal protein L35
MSKLKIKKSVSKRFKVTKTGKVLYKHQMAGHLRRKKSGSNLRRKAIPGQLTGTFAIKIKKLLGQG
Molecular weight: 7.31 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
827 |
27 |
854 |
235,907 |
28 |
1,416 |
285.3 |
32.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.72 |
0.59 |
4.9 |
6.75 |
4.83 |
6.68 |
1.72 |
8.46 |
7.36 |
9.88 |
2.02 |
4.4 |
3.49 |
4.11 |
4.78 |
6.76 |
5.57 |
6.6 |
0.97 |
3.41 |
Note: For statistics only major isoforms were used (in this case 827 proteins)
For dipeptide frequency statistics click
here