Virtual 2D-PAGE plot for 3,439 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A095CLH1|A0A095CLH1_9RHOB Uncharacterized protein
MFGLAGLLGLLVVGVSGVFPTEGPAGEDGENNGDGPFAEGTDDNDTIEGGDEGDSILAHMGDDVVYGGAGDDMLDGGAGDDLLIGAEGDDTLIGATGDDDLPGGLGNDQAAGGEGDDTLLGQAGDDILIGGDGDDRMIGGPGDDILSGGEGNDGLMGGEGDDIVLGGGGADVLNGNAGDDTILGITPDEE WEDDGLRDYLNGGEGDDMLFAGAGDNVNGGEGADDFILGDWIDDGGPALIEDYDASEDTLAVVYDDETHPAPMLTVEPSDEAPDNALLLLDGLPLAEVAGAAGLDLSQVTLVPKSAVAEAMRAAA
Molecular weight: 31.11 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A095CK22|A0A095CK22_9RHOB 50S ribosomal protein L34
MKRTFQPSNLVRSRRHGFRARMATKAGRKILNARRAKGRKSLSA
Molecular weight: 5.07 kDa Isoelectric point according different methods: