Stachybotrys chlorohalonata IBT 40285
Average proteome isoelectric point is 6.48
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 10,676 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A084QIA4|A0A084QIA4_9HYPO Uncharacterized protein
MYRYAILAAAVPMVAAHGFISSPPPRQPGEAFGAACGAQALNQQAADINGNVQGIMQVIDARTISDDCNLWLCKGFLLEDPSLVQSYTLGQTIDFEIDIAAPHTGVANVSVVRTSTNSIIGAPLIEFENYASTATGVDPSNRAFSVTLPEDLEGQCTTAGDCVLQWWWDAADINQTYESCVDFTVAGSGS
GSPAPAPSVSTPAPSATAPVVTTAVTPQPTSTPIEEPIEEDDECPADDEEDEDEDEEPVEEDDECPADDEEEEDEEPIEEDDECPADDEEEEVEEPVEEVEEPVEEDDECPAEEEDDASGDVDPDEEYDGVDVEEDDECPADEEEEEEEEPIEEEDDECPAEDDEDEEPIEEEDDECPAEDDEDEEPIEE
EDDECPAEDDEDEEPIEEEDDECPAEEDEEDEEPIEDDDECPAEDEEDDYEETLPVVTSAGIYERAPATTLATVVRKAVATAAF
Molecular weight: 50.56 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A084QMT4|A0A084QMT4_9HYPO Uncharacterized protein (Fragment)
MRWNGTRTSSTLSSPTLTTRRPASAGSASGRSRGRPSPRTRSTTNHRRTRTI
Molecular weight: 5.73 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
10,675 |
1 |
10,676 |
5,257,008 |
8 |
8,218 |
492.5 |
54.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.07 |
1.21 |
5.89 |
6.06 |
3.62 |
6.95 |
2.45 |
4.68 |
4.45 |
8.94 |
2.22 |
3.54 |
4.06 |
6.13 |
6.31 |
8.06 |
5.89 |
6.28 |
1.49 |
2.69 |
Note: For statistics only major isoforms were used (in this case 10,675 proteins)
For dipeptide frequency statistics click
here