Brevundimonas sp. Root1279
Average proteome isoelectric point is 6.34
Get precalculated fractions of proteins
Acidic |
![](../download.png) |
pI < 6.8 |
![](../download.png) |
6.8-7.4 |
![](../download.png) |
pI > 7.4 |
![](../download.png) |
Basic |
![](../download.png) |
All |
![](../download.png) |
Virtual 2D-PAGE plot for 3,236 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0Q7E1W4|A0A0Q7E1W4_9CAUL Uncharacterized protein
MAVFEGGSGKDVYVGGADPDTIRGNGGHDRLDGGGGNDVVEGGAGNDELRGGAGRDRVDGGIGNDLIWGVDDGDFLAGEEGNDWVSGDAGNDNVSGGDGNDVVLGGDGNDNVDGDDGNDVLFGGAGGDDIVAGDGNDILWGDEGDDDLQGGAGDDLMYGGVGDDDLTGYEGVDISLGGAGSDTFGFFLGE
FAPSSTLAAQDIVLDFEGAGQEGGDFISLNFETVAFGGEINVRVREGSLLPGAGDGVTQIFYTQRQGSTWLIADENDNGVLDDSDFTVEFFGTHDFTQADFDRTNFVIVGTAGPDVIDGTEDADRIFGAGGDDTINGLGGDDELNGGDGDDVLDAGTGSFDVLNGDAGDDTLTAANSDVGVLFGGEGNDT
LFGSDVGFFSDLQGGNGDDTIYAGATSASVSGGDGADVLVSNAGDDQLNGGYNEDFTLDGDPDLFVYGAGAWGTDNVYQFEDGSDLFDLRGSGLTFADLTIVNEDFQTTITSANGTIFIQEFDGPITITADDFLFS
Molecular weight: 52.4 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0Q7ECZ4|A0A0Q7ECZ4_9CAUL 50S ribosomal protein L34
MKRTYQPSRLVRKRRHGFRSRMATTNGQKIVARRRAKGRKRLTA
Molecular weight: 5.28 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,230 |
6 |
3,236 |
1,014,224 |
41 |
4,215 |
314.0 |
33.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
13.73 |
0.69 |
6.16 |
5.75 |
3.5 |
9.43 |
1.76 |
4.34 |
2.69 |
9.74 |
2.24 |
2.44 |
3.07 |
5.45 |
7.24 |
5.04 |
5.43 |
7.72 |
1.51 |
2.08 |
Note: For statistics only major isoforms were used (in this case 3,230 proteins)
For dipeptide frequency statistics click
here