Tropicibacter multivorans
Average proteome isoelectric point is 6.11
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,869 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0N7M019|A0A0N7M019_9RHOB Hemolysin plasmid
MLWVAGLIGVLAAGSVSLLSFEDEDEQDQDAEGSTAEDATAEEPARVSLSQFLFGNDSDTGDDEGTADSTGEDTGEDTVSGPVIVDPLPPSEDPSAPVTETPAPAGGVTLTGTDALDQMDGGDGDDTLTGLDGDDQINGRAGDDSLSGGLGDDQLYGGAGADSLGGDVGADLLHGEAGADTLAGGDGEDT
LYGHFGADSLLGGAGDDAAHGGQDSDTLDGDAGADSLHGNDGDDFLRGGSGQDALFGGDGDDTVNGADDAEADFVNGGDGDDLLAAGAGDVVTAGDGADNILLGDWIAGGTVELIDFDAAEDQLLVVYDAALGAPEVEVATDPDNPDQLVVSLDGETAMYVQGAGDLTVADILLVEATDEDFAYLPLG
Molecular weight: 37.36 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0N7LZF7|A0A0N7LZF7_9RHOB 50S ribosomal protein L34
MKRTYQPSNLVRKRRHGFRARMATKAGRKILNARRARGRKSLSA
Molecular weight: 5.15 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,868 |
1 |
3,869 |
1,235,619 |
31 |
2,766 |
319.4 |
34.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.08 |
0.93 |
6.13 |
6.03 |
3.85 |
8.52 |
2.06 |
4.93 |
3.43 |
10.25 |
2.75 |
2.76 |
3.55 |
4.93 |
6.22 |
5.32 |
5.5 |
7.18 |
1.35 |
2.22 |
Note: For statistics only major isoforms were used (in this case 3,868 proteins)
For dipeptide frequency statistics click
here