Mycoplasma penetrans (strain HF-2)
Average proteome isoelectric point is 7.13
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,028 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q8EUK1|Q8EUK1_MYCPE Putative uncharacterized protein MYPE9240
MNLTKKLWIKVKDSQTQQLIISSLLTDYLEKDLIESFGIYEKDINQELTFLDNNSFYLTFDDNFDYFAFCKLISKEFKTRMLCWISGNFFYFDDNGFFSNSKNPFENDQNSFSNQEDISDLFVNSDSEKEFKESEEKDKNDDVLDTILESSENFYVELEKKLTENEEKIEDEILNSLSSESFIDELNMWN
DFKENVLSGTAFADDSENSKENECCKDDCCEEVCAEDACCSSCSDEFDLCLSGCCNWNECCSNDGCKDECCNQDTEEVEEQVILSEFDDFGLLDSNDELFVFSNNDSESEENCCSTDGSCACSEVENDDSCCGDSCCSEEENSNEFEEEYKSYLDLLDANDDEESCENCNCSSSSDELNLEFLDFSSSED
KKEDSSCCDEDMCSTCDGCSWDFDSDFDHNEILKTQINNSNQEDFGYVEYVEEDNKTDDNDLSHHFECVCEDKVMEETQNISTINKEVDFTDNEEIKETESISTLFDEVNEMKANEEIFNKDDEKNELNFDDNSNSSVVEEEEYDQLFSNLESLDGSDSIENIEEEVNLDFFNTPSIEDIKNKDLITAEE
LELLLESNESSSEPLTEQKINQELDLDNLSEDKKSLDFESFFTEITSDDLAEEPNFNDFANQEDAQSVEEEPIDFESFFTEITNETSENNDVNVENLGPFFTEISNEDLIEKASFSDLVPEDHSSFDEPESVDYSAFLPEIGNENEVKSEVKLDLDSLSDEKFVDTEFNVEELYSFQTSDDDSKPTVESP
SSLEEEVKEFFSDLSAELSNIPDVVENKKENNDDIVIEDISINSDLDSLDLSSSQLFETEFLPNELKLDEEMNNQFSTLVSPSTESSKEADVYEPNISADKIVSDKQITSDLQKFLEDLKVEKEKLRMRRVNLEKKTAKIKNMFNDLNSSSDFNN
Molecular weight: 104.92 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q8EUF5|Q8EUF5_MYCPE Putative uncharacterized protein MYPE9720
MPEAKTTRSSVSKAPLVSVAANSEANPTVNPSLNTNGLQQVKVSPTLTGRPSAQSVRPNPTMVARPTAQPARPNPTMPARPTAQPVRPNPAVNGRPSPAVLRPTPTRPTVISQRPNATYSRPAGSYSGK
Molecular weight: 13.48 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,028 |
0 |
1,028 |
397,721 |
47 |
3,317 |
386.9 |
44.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.71 |
0.72 |
5.62 |
6.03 |
5.34 |
4.82 |
1.1 |
8.97 |
9.53 |
8.96 |
1.71 |
8.75 |
2.94 |
2.57 |
2.39 |
8.47 |
6.14 |
5.82 |
0.96 |
4.45 |
Note: For statistics only major isoforms were used (in this case 1,028 proteins)
For dipeptide frequency statistics click
here