Virtual 2D-PAGE plot for 10,365 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|R1EV59|R1EV59_BOTPV Uncharacterized protein
MQKTLDPVFNEKYPNPGYFLVRLGRLFADDSNLNEDEEDEEDDDDEEDEEDDDDEEDEEDDDDEEDEEEEDDEEDEEGDDDKEDGEDDDEEDKEGGDDEEDEDYVYGEGEEDEDEEDDEYYEYLEDSDEEEDDDMEEDDDIEEDDNMEEDDDMEEDSGMEEDDDMEEDSDMEENSGMEEDDGMRESVQGL VFRLRGPTEV
Molecular weight: 23.61 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|R1G8F8|R1G8F8_BOTPV Uncharacterized protein
MRTALLHTSSEMMALGLNAAAFGVAAYLPARYFGPMLFPRRAARAQQRAEARAQSTLAQNNAAIAGAGAAAVGGAAAASQFGSGASHGWIGSARALLRLGTRGRGGGNF
Molecular weight: 10.97 kDa Isoelectric point according different methods: