Desulfocapsa sulfexigens (strain DSM 10523 / SB164P1)
Average proteome isoelectric point is 6.46
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,514 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|M1PF17|M1PF17_DESSD Uncharacterized protein
MTDNTSGAGNTGHAGPIGQVFVIFGEVKAIAPDGSMRTLAPNSPIFADERILTGGDGRISINFNDPEHTVLSLGRNSDVVIDEEVYNQSPTEDFTEATSEVADVQKALEANDTFDPTTELPATAAGPAAGAGGVAGARDGGASYPVFNLTGEAVTPVSGAETTGVDRSFLDPNIPTTPPEGAAPTTTPTT
TPTTTPTTTPTTTPTTTPTTTPTTTPTTTPTTTPTDTPTETPTETPTETPTETPTETPTQTPTTPGDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDRDDGGDDDDDDGGDDDDDGGDDDDDFGDFTDDHLVEPPTETF
Molecular weight: 60.03 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|M1PJY1|M1PJY1_DESSD 50S ribosomal protein L35
MPKMKTNRGAAKRFSKTGSGKIKRSKAFTSHILTKKSTKRKRNLRKSGIVDSSNVPSIRRILPYL
Molecular weight: 7.36 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,483 |
31 |
3,514 |
1,178,029 |
23 |
2,577 |
338.2 |
37.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.67 |
1.33 |
5.49 |
6.5 |
4.47 |
7.15 |
2.17 |
7.01 |
5.71 |
10.5 |
2.59 |
3.95 |
3.69 |
4.07 |
5.01 |
6.58 |
5.46 |
6.69 |
1.02 |
2.93 |
Note: For statistics only major isoforms were used (in this case 3,483 proteins)
For dipeptide frequency statistics click
here