Sulfuricurvum kujiense (strain ATCC BAA-921 / DSM 16994 / JCM 11577 / YK-1)
Average proteome isoelectric point is 6.23
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 2,794 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|E4TXZ4|E4TXZ4_SULKY Uncharacterized protein
MKILLFNDNPVVRKLVALSAQKTKDDLSVVWSTDEIEGNEYDLLIVDDALYSDEILDSINEKIVAKNTLFMATRGKAVPSGFDNVINKPFLPTDLVDMFVQIEKKVSVGRDQSDNEVEEHASSTSTYAINLEDSLSELEGDETEALVGAEDDLDFGDLDDYEDKLPETAILDQEEVQEVQELLEDTEEDD
LTMDDEFSVEGSAPISLPDEEIGVPIELEDDFSLDDANIIDEEKEEEELLGFDDIEENEIPSDEEVPKNDLSEDDEFGDLELPEPLEESSGLSDEDELLSMGEDDALGELELPEDDGLSDMNDATSFDLSGLEEMDESMLMDDDELGDLESKIEDAVGGLESEELERELETDDFDLSLNDEMMEELMSTE
EENLMDTGSFDELDMLDERELKIAVGEEVEEEDEPVLVAKGGSSLAAEALDEVLNESSPYAEFTDEIEEAEPVASHAEGVEALQALLKALSNENVSKSLKGMNISININFGNGA
Molecular weight: 54.62 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|E4U0E4|E4U0E4_SULKY 50S ribosomal protein L34
MKRTYQPHNTPRKRTHGFRARMATKNGRRVLNARRAKGRKRLAV
Molecular weight: 5.24 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
2,780 |
14 |
2,794 |
862,336 |
30 |
3,343 |
310.2 |
34.8 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.73 |
0.9 |
5.55 |
7.08 |
4.59 |
6.38 |
2.31 |
7.92 |
6.46 |
9.83 |
2.78 |
4.54 |
3.23 |
3.4 |
4.38 |
6.8 |
5.41 |
6.18 |
0.85 |
3.7 |
Note: For statistics only major isoforms were used (in this case 2,780 proteins)
For dipeptide frequency statistics click
here