candidate division KD3-62 bacterium DG_56
Average proteome isoelectric point is 6.68
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 990 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0S7XNV2|A0A0S7XNV2_9BACT Uncharacterized protein
METGCDRSQDFTLTATDGCGNSSTCVVTYTWVEDVTGPVISGCPVSAIDLGADALAEGVTADDACDGPITPTCSAGTVVETGCDRSQDFTLTATDGCGNSSTCVVTYTWKVDTTDPVITGYPADQEIYADENCEGTIPDLTDDVVATDTCTPAANLVVTQDPLPGTTVGLGPTDVTLTVTDGCGNDSTCT
VTLTVVGEPISFNITGNCWQMITVPYNLVSTDPWVVFDELHNGTDLLSGALHRYNGSGYETYIKDILEFDLVPGEGYWLWAFSNDTIQYEACGPTAPAPIVVDYGSAGWHMMGYPKDIGQMDVASVIFRYDAMDYTFAEVAYSWISDPMYGYRASIVGYETVGIEPWDMNDKIYGFRGYWLYTYLDNVSL
VAP
Molecular weight: 41.16 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0S7XKX7|A0A0S7XKX7_9BACT Uncharacterized protein
MGPGRHRARPRPQPPRPRTRLLAGCTTAARTPPEHRSDRDLPSPRRSGGKPRRPHLALRAPARRRSLPIRQ
Molecular weight: 8.06 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
986 |
4 |
990 |
316,622 |
31 |
2,550 |
321.1 |
35.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
11.35 |
1.29 |
5.99 |
6.3 |
3.06 |
8.66 |
2.19 |
5.01 |
2.57 |
9.21 |
2.18 |
2.3 |
3.16 |
5.69 |
7.89 |
5.1 |
5.44 |
8.1 |
1.73 |
2.77 |
Note: For statistics only major isoforms were used (in this case 986 proteins)
For dipeptide frequency statistics click
here