Veillonella sp. DORA_A_3_16_22
Average proteome isoelectric point is 6.25
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,455 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|W1WY15|W1WY15_9FIRM Uncharacterized protein (Fragment)
MDADVEAAVAEPAALSSLTFALEADIEAAVAEPAALSSLTFALEADVDAAVAEPAALSSLTFALDADVDAAVAEPAALSSLTFALDADVDAAVAEPAALSSLTFALDADVLAAVAALDAVVALAAALSSLTFALDAEVLAAVAELDAVVALAAALSSLTFALDADVLAAVAEPAALSSLTFALDADVEAA
VADPAALSSLTFALDADVLAAVAELDAVVALAAALSSLTFALDADVEAAVAELDAVVALAAALSSLTFALDADVDAAVADPAALSSLTFALDADVEAAVAEPAALSSLTFALDADVDAAVAEPAALSSLTFALDADVLAAVAEPAALSSLTFALDADVL
Molecular weight: 33.75 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|W1W5X6|W1W5X6_9FIRM Uncharacterized protein
MRRKKQLKKRNNSPSPIVTTTAMKQRQNHKHTKKIGDVIVTIPCFGKSRSRSR
Molecular weight: 6.17 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,424 |
31 |
3,455 |
761,091 |
20 |
2,750 |
222.3 |
24.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
8.16 |
0.98 |
5.81 |
6.29 |
3.74 |
7.46 |
2.15 |
7.5 |
6.12 |
8.94 |
2.87 |
4.71 |
3.35 |
3.65 |
4.18 |
5.76 |
6.06 |
7.53 |
0.92 |
3.71 |
Note: For statistics only major isoforms were used (in this case 3,424 proteins)
For dipeptide frequency statistics click
here