Candidatus Giovannonibacteria bacterium GW2011_GWB1_45_9b
Average proteome isoelectric point is 7.38
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 410 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0G1R532|A0A0G1R532_9BACT Uncharacterized protein (Fragment)
LIGKYNITTNSSDHPSGAVLAEIGEEAVGADGAFIAYIGGDAGAVSGGSAFTVRSLNSTSGSGFDYGLDLLTTTIDSYLPLSFGVADIRLLNGETISNATNGVIDMSGAAVLNRIATSSPTTDTTLTAAQSGTTFFIGTAGVDLTLPAIAGTSGVWYRFVVSAAVADTNQTVIAPTAILNGPIDVNSTLV
LCTDEATIAFVQTADTAGDWVEVRSNGTKWFVTGQAQAVGGITCS
Molecular weight: 23.73 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0G1R728|A0A0G1R728_9BACT 50S ribosomal protein L15
MQAHQIKSSGDKRRKRVGRGGKRGTTSGRGTKGQKARSGRRIRPQFRDILKKIPKKKGYRAKIVSRPIAVVNLRDIDRKFLEGSEINPGVLVEKGLVSRISGKVPRVKILGSGELTKKFIIRNCLFSKKAQVAWKKYS
Molecular weight: 15.52 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
409 |
1 |
410 |
111,928 |
28 |
2,076 |
273.7 |
30.4 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.91 |
0.7 |
5.03 |
6.64 |
4.9 |
7.63 |
1.56 |
7.92 |
7.56 |
9.4 |
1.98 |
4.39 |
2.63 |
3.92 |
4.94 |
6.99 |
5.32 |
6.28 |
1.15 |
3.12 |
Note: For statistics only major isoforms were used (in this case 409 proteins)
For dipeptide frequency statistics click
here