Pararhodospirillum photometricum DSM 122
Average proteome isoelectric point is 7.05
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 3,275 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|H6SIF0|H6SIF0_RHOPH HEMAGGLUTININ/HEMOLYSIN-RELATED PROTEIN (Fragment)
TATDTLSVTVTPVADAPVLPAASAVGNEDTAIALNLAPVLTDTDGSETLSITISNVPAGATLSAGTPNPDGSYTLTPAELSGLTITPPVNSDVDFSLTVTATSQDGASTANTTISVPVTVIAVADQVTVDASAPASVAEDTPIPLTITTATPDTDGSETISLKISGLPTGATLSAGTPNADGSYTLTPAQ
LEGLTLTPPTNYSGTIALTVVSTTTEAENGSFTKATDTLSVTVTPVADAPVLPAASAVGNEDTAIALNLAPVLTDTDGSETLSITISNVPTGATLSAGTPNPDGSYTLTPAELSGLTITPPVNSDVDFNLTVTATSQDGTTTANTTITVPVTVIAVADQVTVDASAPASVAEDTPIPLTITTATPDTDGS
ETISLKISGLPTGATLSAGTPNADGSYTLTPAQLEGLTLTPPTNYSGTITLTVVSTTTEAENGRFKTATDTLSVTVTPVADAPVLPAASAVGNEDTAIALNLAPVLTDTDGSETLSITISNVPAGATLSAGTPNPDGSYTLTPAELSGLTITPPVNSDVDFSLTVTATSQDGASTANTTISVPVTVIAVA
DQ
Molecular weight: 56.36 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|H6SKB8|H6SKB8_RHOPH 50S ribosomal protein L34
MKRTYQPSRLVRKRRHGFLSRSATVGGRRVLAARRAKGRKRLSA
Molecular weight: 5.09 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,254 |
21 |
3,275 |
1,083,706 |
40 |
3,392 |
333.0 |
35.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.72 |
0.96 |
5.46 |
5.54 |
3.21 |
8.87 |
2.11 |
3.97 |
2.5 |
11.25 |
2.2 |
2.04 |
3.21 |
6.05 |
8.05 |
5.2 |
5.65 |
7.88 |
1.32 |
1.79 |
Note: For statistics only major isoforms were used (in this case 3,254 proteins)
For dipeptide frequency statistics click
here