Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
Average proteome isoelectric point is 6.76
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 16,676 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q16KJ0|Q16KJ0_AEDAE AAEL012968-PA (Fragment)
VDGGASVAVVDSTVLLGSLVTVEGSTVGAEAVVISGVVDDSVETVDGLSVTVESSVVTSGVMDDSVETVDGLSVTVESSVVISGVVGDSVETVDGLSVTVENSVVTSGVMDDSVETVDGLSVTVENSVVISGVVGDSVETVDGLSVTVESSVVTSGVVDDSVETVDGLSVTVENSVVISGVVGGGSVDIV
DGLSVGVGTVDGGTVESSTVGAEAVVISGVVDDSVETVDGLSVTVESSVVTSGVMDDSVETVDGLSVTVESSVVISGVVGDSVETVDGLSVTVESSVVTSGVMDDSVETVDGLSVTVESSVVISGVVGDSVETVDGLSVTVESSVVTSGVVDDSVETVDGLSVTVENSVVISGVVGGGSVDIVDGLSVVV
KGNSVEMVDGLSVVASGVTDGESVVIADEPSVVPSSV
Molecular weight: 40.38 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q0IFQ6|Q0IFQ6_AEDAE AAEL004164-PA (Fragment)
IKLVSRKTKLISRKTKLVSKKTKLVSKKTKLVSRKTKLVSRRTKLVFRKTKLVSKKTKLQKKDQLISRKINLVSRKTKIVFRKTKLITRKTKLVSKKTKLVSKKTKLVSRKTKLVSRRTKLTKLVSRKTKLVSRRTKLVSRKTKLISKKTKIVFRKTKMVFKKIKMVFRKTKMVSRKTKLVSRRTKLVSR
KTKLISKKTKIVFRKTKMVFKKIKMVFRKTKMVSRKTKLTKIVFRKTKMVFKKIKMVFRKTKMVSRKTKLVSRRTKLIVFRKTKMVFKKIKMVFRKTKMVSRKSKMVLKKKTKIVFRKTKMVFKKIKMVFRKTKMVSRKTKLIKLVSRNTKLVSRKTKMVSRKTKMVSRKTKMVSRKTKMVSRKTKMVSR
KTKMVSRKTKMVSRKTKLVFRKTKLVFRKAKMVFRKTKMVFRKTKMVFRKTKKDQD
Molecular weight: 52.41 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
15,349 |
1,327 |
16,676 |
7,184,848 |
26 |
11,328 |
468.1 |
52.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
6.5 |
2.01 |
5.48 |
6.55 |
3.93 |
5.76 |
2.58 |
5.51 |
6.16 |
8.91 |
2.4 |
4.91 |
4.46 |
5.18 |
5.35 |
8.15 |
5.72 |
6.23 |
1.03 |
3.18 |
Note: For statistics only major isoforms were used (in this case 15,349 proteins)
For dipeptide frequency statistics click
here