Virtual 2D-PAGE plot for 4,865 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A0M2ZH99|A0A0M2ZH99_9MYCO Uncharacterized protein
MTNQGLTPEELAAEMAVALPDKEVVSILDLDVDVDVFLDVASPIDLAVAAQLNVAAPIDAAAGANVLSFNSTAGAMVEQTAQVDQIIEADAFAVADQDSAIDQSDVADGDPTEPGDDDDDGDVQVGNLTTLQGPFLDVNVNVDVDTDLTAPIAGAVAANANVAAPISAAVAANVLTIDSDADAIATQDAV INQELRGTTSAEAIQVSDVVQGTAQPDTDTDTATGTASGESAATGGADGGSDGDSGGSGGDSGGSGGDSAGSGGSGGDGGGSTG
Molecular weight: 26.39 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0M2ZCT5|A0A0M2ZCT5_9MYCO Uncharacterized protein (Fragment)
MGRVARIVSGQTWTPRYHAGGGGAGGSASGGGGGIPGAGGGGGGGTASSLPIAASRSLILRRRPGRSSGTGGGSAGTSSGGGGAASG
Molecular weight: 7.64 kDa Isoelectric point according different methods: