Proteome-pI - Proteome Isoelectric Point Database statistics

Neisseria shayeganii 871

Taxonomy: cellular organisms; Bacteria; Proteobacteria; Betaproteobacteria; Neisseriales; Neisseriaceae; Neisseria; Neisseria shayeganii

Average proteome isoelectric point is 7.24

Get precalculated fractions of proteins

Acidic

pI < 6.8

6.8-7.4

pI > 7.4

Basic

All

Virtual 2D-PAGE plot for 2,530 proteins (isoelectric point calculated using IPC_method)

Get csv file with sequences according given criteria:

* You can choose from 18 different methods for calculating isoelectric point

Protein with the lowest isoelectric point:

>tr|G4CEL9|G4CEL9_9NEIS Uncharacterized protein 

MYEINRSVFLLVPQVPFWNWLTSIPGIDLADFTLEDLQADANAYLVDPCDDFEEVWAEIEPQLETIFAAELADWCEDESLWPDLHPDIFTEWFDIQLSSIVTDLSSQALEREAFVPLQVQ

Molecular weight: 13.9 kDa
Isoelectric point according different methods:

Protein with the highest isoelectric point:

>tr|G4CHG9|G4CHG9_9NEIS 50S ribosomal protein L34 

MKRTYQPSVTKRKRTHGFLVRSKTRGGRAVLAARRAKGRKRLAV

Molecular weight: 5.05 kDa
Isoelectric point according different methods:

General Statistics

Number of major isoforms	Number of additional isoforms	Number of all proteins	Number of amino acids	Min. Seq. Length	Max. Seq. Length	Avg. Seq. Length	Avg. Mol. Weight
2,528	2	2,530	666,009	32	2,826	263.5	29.0 kDa

Amino acid frequency

Ala	Cys	Asp	Glu	Phe	Gly	His	Ile	Lys	Leu	Met	Asn	Gln	Pro	Arg	Ser	Thr	Val	Trp	Tyr
11.74	1.12	5.05	5.71	3.85	7.61	2.57	4.92	3.99	10.84	2.5	3.35	4.69	4.8	6.4	5.26	4.65	6.72	1.43	2.8

Note: For statistics only major isoforms were used (in this case 2,528 proteins)
For dipeptide frequency statistics click here

See this proteome in:

Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here

Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978

Contact: Lukasz P. Kozlowski