Rotavirus A (isolate Monkey/South Africa/SA11-H96/1958 G3-P5B[2]-I2-R2-C5-M5-A5-N5-T5-E2-H5) (RV-A) (Simian Agent 11 (isolate SI/South Africa/H96/58))
Average proteome isoelectric point is 6.44
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 13 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|A2T3P5-2|VP7_ROTSH Isoform of A2T3P5 Isoform 2 of Outer capsid glycoprotein VP7
MDFIIYRFLFIIVILSPFLRAQNYGINLPITGSMDTAYANSTQEETFLTSTLCLYYPTEAATEINDNSWKDTLSQLFLTKGWPTGSVYFKEYTNIASFSVDPQLYCDYNVVLMKYDATLQLDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTIKVCPLNTQTLGIGCLTTDATTFEEVA
TAEKLVITDVVDGVNHKLDVTTATCTIRNCKKLGPRENVAVIQVGGSDILDITADPTTAPQTERMMRINWKKWWQVFYTVVDYVDQIIQVMSKRSRSLNSAAFYYRV
Molecular weight: 33.81 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|A2T3R0|NSP6_ROTSH Non-structural protein 6
MNRLQQRQLFLENLLVGVNSTFHQMQKHSINTCCRSLQRILDHLILLQTIHSPVFRLDRMQLRQMQTLACLWIHQHNHDLQVMSDAIKWISP
Molecular weight: 11.01 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
12 |
1 |
13 |
5,897 |
92 |
1,088 |
491.4 |
56.6 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.31 |
1.12 |
6.05 |
5.48 |
4.43 |
3.39 |
1.61 |
8.09 |
6.44 |
9.53 |
3.0 |
7.07 |
4.29 |
3.37 |
4.77 |
7.66 |
6.39 |
5.95 |
1.1 |
4.93 |
Note: For statistics only major isoforms were used (in this case 12 proteins)
For dipeptide frequency statistics click
here