candidate division Zixibacteria bacterium SM23_73_2
Average proteome isoelectric point is 7.12
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,857 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|A0A0S8IZB8|A0A0S8IZB8_9BACT Uncharacterized protein (Fragment)
MLVDDGALVSSPDTVLVSVNNQAPLADAGSDQLGTEANTLVTLDGSGSSDPDGDSLGYHWAQISGPSVSLSDSNIVNPTFTPTIKGNYEFELLVDDAYLLSSPDTVLVSIDNQAPVADAGADQLGIEANTLVTLDGSGSSDPDGDSLGYHWAQISGPLVSLSDSNIVDPTFTPTIKGNYEFELLVDDGDL
ISSPDTVLVSIDNQTPVADAGADQSGVEANTLVTLDGSGSSDPDGDSLGYHWAQISGPSVSLSDSNIVDPTFTP
Molecular weight: 27.06 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|A0A0S8J1A4|A0A0S8J1A4_9BACT 50S ribosomal protein L35
MPKLKSSRSASKRFKITKTGKIRRNKAYKSHLLSSKNAKRKRRLRKSTLVVKADQKRIKRMLSK
Molecular weight: 7.55 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,845 |
12 |
1,857 |
588,575 |
29 |
2,596 |
319.0 |
36.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.81 |
1.08 |
5.71 |
7.11 |
5.26 |
7.22 |
1.55 |
7.47 |
8.39 |
10.18 |
2.09 |
4.02 |
2.89 |
3.96 |
4.49 |
6.48 |
4.74 |
6.61 |
1.21 |
3.73 |
Note: For statistics only major isoforms were used (in this case 1,845 proteins)
For dipeptide frequency statistics click
here