Virtual 2D-PAGE plot for 1,296 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|A0A0G1MW75|A0A0G1MW75_9BACT Uncharacterized protein
MGVTVGVGVGVTVGVGVGVGVTVGVGVGVGVGVSVGVGVGVSVGVGVGVSVGVGVGVTVGVGVGVSVGVGVGVTVGVGVGVSVGVGVGVSVGVGVGVTVGVGVGVSVGVGVGVGVGVSVGVGVGVGVGVGVIVGVGVGVTVGVGVGVIVGVGVGVGVSVGVGVGVIVGVGVGVTVGVGVGVTVGVGVGVS VGVGVGVTVGVGVGVSVGVGVGVTVGVGVGVGVGVGVGVSVGVGVGVIVGVGVIVGVGVGVTVGVGVGVGVGVGVIVGVGVGVGVSVGVGVGVGVGVGVGVSVGVGVGVTIGVGVGVTVGVGVSVGVGVGVGVSVGVGVGVSVGVDVGVGVGVIVGVGVGVSVGAGVGVTVGVGVGISVGVGVGVGSTS
Molecular weight: 31.37 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|A0A0G1JLA8|A0A0G1JLA8_9BACT Ribonuclease P protein component
MLPKSHRLSRKTLLELRKTGKRLQLDTFSIVFGPNHLNHLRLSTEISTKVDKRSSRRNAIRRQLYLHVQKTPLIAKSVDVLIIVRPTAKKLIPQTASFKQAVNLVVRALLV
Molecular weight: 12.73 kDa Isoelectric point according different methods: