Virtual 2D-PAGE plot for 20,824 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|L9KJJ1|L9KJJ1_TUPCH Uncharacterized protein
MRWDIMMVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTV GCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEDDDGDIMTVGCEEEG
Molecular weight: 30.37 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|L9L7K0|L9L7K0_TUPCH Uncharacterized protein
MPPPGVPGGNAGRGGGAQAAPQRPARRPGPPPAGRPGAVTPPGGAAARLALAQRERFSPVRGGGAGRLRFISRRHPQAPGRRNESPRAQGHVRRTWTLRAPVT
Molecular weight: 10.64 kDa Isoelectric point according different methods: