Virtual 2D-PAGE plot for 2,076 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|S2W6E6|S2W6E6_9ACTN Uncharacterized protein
MADVFDDERAEDLSNSADESNTDDLDLSAEESLDDDEDLDGGVIHDDYDDFDDDDEDDYDDYDDYEDYEDATVADVDFVVALYREDGEPTVVELPFPAANDLDEMISQLSRLPGDGGALGVVSIAGEFFVLCRVRGNKIQVLLNDSLASCDWPIARDVMDYLGIEVPSEDDDDEVIGDLGMLEDQGVSEF EMEQIAGDADEDSDQLVLQIVDEMHFGAQFDKVVN
Molecular weight: 24.93 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|S2WJU1|S2WJU1_9ACTN Uncharacterized protein
MAWSGAVRHGSLGAAWRGSGFGPRVCLRDLRARPLILTRQSRHGWARWGVVWFGSARCGSLGLARSGMAWQGMAWRGKVFNAWLGCERRKLPSRSGWADYFDMAVLARPGEAWRGWVGQGVAVKAGQGSARFRWARHGSLGAAWQGTARRGKAGWGQA
Molecular weight: 17.31 kDa Isoelectric point according different methods: